PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00464.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 285aa    MW: 32785.1 Da    PI: 8.1713
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00464.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++lv ++k +G g+W++ +r  g+ R++k+c++rw +yl
  Rsa1.0_00464.1_g00005.1 14 KGAWTKEEDDKLVSYIKSHGEGCWRSLPRSAGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding56.85.2e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Rsa1.0_00464.1_g00005.1  67 RGNFTLEEDDLIIKLHSLLGNK-WSLIATRLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.401961IPR017930Myb domain
SuperFamilySSF466892.81E-2913108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001671.07E-91661No hitNo description
PROSITE profilePS5129428.26662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2765116IPR009057Homeodomain-like
SMARTSM007172.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.6E-1667111IPR001005SANT/Myb domain
CDDcd001673.57E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRSPCCEKD HTNKGAWTKE EDDKLVSYIK SHGEGCWRSL PRSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TLEEDDLIIK LHSLLGNKWS LIATRLPGRT DNEIKNYWNT HVKRKLLRGG  120
IDPITHRPIN ETKAPRVSSE PRDTEDSLVK FLSFSRQLEI KESCGDNKRN NQEGLICKKE  180
RVEYSVVEER CLDLNLELRI SPPWQDQQQH HDETKLRFGR EKFRCTACRF RLGNGKECSC  240
HNVNCQVEDS TSSSNSSSDI SCSVVGYDFL GLNTSVLDFC SLEMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382821e-148KF738282.1 Brassica napus MYB transcription factor 32-2 (MYB32-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013670604.11e-172PREDICTED: transcription factor MYB32-like
SwissprotO496081e-149MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A078CK701e-172A0A078CK70_BRANA; BnaA01g02240D protein
STRINGBra011576.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34990.11e-148myb domain protein 32